http://www.cnr.it/ontology/cnr/individuo/prodotto/ID310563

High-Yield Nontoxic Gene Transfer through Conjugation of the CM18-Tat(11) Chimeric Peptide with Nanosecond Electric Pulses (Articolo in rivista)

Type

Prodotto della ricerca (Classe)
Articolo in rivista (Classe)

Label

High-Yield Nontoxic Gene Transfer through Conjugation of the CM18-Tat(11) Chimeric Peptide with Nanosecond Electric Pulses (Articolo in rivista) (literal)

Anno

2014-01-01T00:00:00+01:00 (literal)

Http://www.cnr.it/ontology/cnr/pubblicazioni.owl#doi

10.1021/mp500223t (literal)

Alternative label

Salomone, Fabrizio[ 1,2,3 ] ; Breton, Marie[ 4 ] ; Leray, Isabelle[ 4,5,6 ] ; Cardarelli, Francesco[ 3 ] ; Boccardi, Claudia[ 3 ] ; Bonhenry, Daniel[ 7 ] ; Tarek, Mounir[ 7 ] ; Mir, Lluis M.[ 4,5,6 ] ; Beltram, Fabio[ 1,2,3 ] (2014)
High-Yield Nontoxic Gene Transfer through Conjugation of the CM18-Tat(11) Chimeric Peptide with Nanosecond Electric Pulses
in Molecular pharmaceutics (Print)
(literal)

Http://www.cnr.it/ontology/cnr/pubblicazioni.owl#autori

Salomone, Fabrizio[ 1,2,3 ] ; Breton, Marie[ 4 ] ; Leray, Isabelle[ 4,5,6 ] ; Cardarelli, Francesco[ 3 ] ; Boccardi, Claudia[ 3 ] ; Bonhenry, Daniel[ 7 ] ; Tarek, Mounir[ 7 ] ; Mir, Lluis M.[ 4,5,6 ] ; Beltram, Fabio[ 1,2,3 ] (literal)

Pagina inizio

2466 (literal)

Pagina fine

2474 (literal)

Http://www.cnr.it/ontology/cnr/pubblicazioni.owl#numeroVolume

11 (literal)

Rivista

Molecular pharmaceutics (Rivista)

Http://www.cnr.it/ontology/cnr/pubblicazioni.owl#pagineTotali

9 (literal)

Http://www.cnr.it/ontology/cnr/pubblicazioni.owl#numeroFascicolo

7 (literal)

Note

ISI Web of Science (WOS) (literal)

Http://www.cnr.it/ontology/cnr/pubblicazioni.owl#affiliazioni

[ 1 ] Scuola Normale Super Pisa, NEST, I-56127 Pisa, Italy [ 2 ] CNR, Ist Nanosci, I-56127 Pisa, Italy [ 3 ] Ist Italian Tecnol, NEST, Ctr Nanotechnol Innovat, I-56127 Pisa, Italy [ 4 ] CNRS, Lab Vectorol & Therapeut Anticanc, UMR 8203, F-91405 Orsay, France [ 5 ] Univ Paris 11, Lab Vectorol & Therapeut Anticanc, UMR 8203, F-91405 Orsay, France [ 6 ] Inst Gustave Roussy, Lab Vectorol & Therapeut Anticanc, UMR 8203, F-94805 Villejuif, France [ 7 ] Univ Lorraine, CNRS, UMR Struct & Reactivite Syst Mol Complexes 7565, F-54003 Nancy, France (literal)

Titolo

High-Yield Nontoxic Gene Transfer through Conjugation of the CM18-Tat(11) Chimeric Peptide with Nanosecond Electric Pulses (literal)

Abstract

We report a novel nontoxic, high-yield, gene delivery system based on the synergistic use of nanosecond electric pulses (NPs) and nanomolar doses of the recently introduced CM18-Tat(11) chimeric peptide (sequence of KWKLFKKIGA-VLKVLTTGYGRKKRRQRRR, residues 1-7 of cecropin-A, 2-12 of melittin, and 47-57 of HIV-1 Tat protein). This combined use makes it possible to drastically reduce the required CM18-Tat(11) concentration and confines stable nanopore formation to vesicle membranes followed by DNA release, while no detectable perturbation of the plasma membrane is observed. Two different experimental assays are exploited to quantitatively evaluate the details of NPs and CM18-Tat(11) cooperation: (i) cytofluorimetric analysis of the integrity of synthetic 1,2-dioleoyl-sn-glycero-3-phosphocholine giant unilamellar vesicles exposed to CM18-Tat(11) and NPs and (ii) the in vitro transfection efficiency of a green fluorescent protein-encoding plasmid conjugated to CM18-Tat(11) in the presence of NPs. Data support a model in which NPs induce membrane perturbation in the form of transient pores on all cellular membranes, while the peptide stabilizes membrane defects selectively within endosomes. Interestingly, atomistic molecular dynamics simulations show that the latter activity can be specifically attributed to the CM18 module, while Tat(11) remains essential for cargo binding and vector subcellular localization. We argue that this result represents a paradigmatic example that can open the way to other targeted delivery protocols. (literal)

Prodotto di